PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G09450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 200aa    MW: 23111.8 Da    PI: 7.5564
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G09450.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.66.7e-1492136347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W++eE+ l++++ +++G+g+Wk I+r+  k Rt  q+ s+ qky
      AT4G09450.1  92 PWSEEEQRLFLEGLNKFGKGDWKNISRYCVKSRTSTQVASHAQKY 136
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.4354IPR001005SANT/Myb domain
PROSITE profilePS5129416.08884141IPR017930Myb domain
SuperFamilySSF466892.73E-1787142IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-1688140IPR006447Myb domain, plants
SMARTSM007171.5E-989139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-1092136IPR009057Homeodomain-like
CDDcd001678.46E-1192137No hitNo description
PfamPF002494.7E-1192136IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MAAFPQWTRV DDKRFELALL QIPEGSPNFI ENIAYYLQKP VKEVEYYYCA LVHDIERIES  60
GKYVLPKYPE DDYVKLTEAG ESKGNGKKTG IPWSEEEQRL FLEGLNKFGK GDWKNISRYC  120
VKSRTSTQVA SHAQKYFARQ KQESTNTKRP SIHDMTLGVA VNVPGSNLES TGQQPHFGDQ  180
IPSNQYYPSQ ENFRGFDQRW
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT4G09450
AtGenExpressAT4G09450
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G09450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G09450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1229110.0AY122911.1 Arabidopsis thaliana unknown protein (At4g09450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192683.11e-150SANT DNA-binding domain-containing protein
TrEMBLQ9M0P71e-150Q9M0P7_ARATH; Putative uncharacterized protein AT4g09450
STRINGAT4G09450.11e-150(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14731719
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]